Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC46A3 Rabbit Polyclonal Antibody (HRP)

SLC46A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FKSG16

UniProt

Q7Z3Q1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC46A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_861450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HELLS (Helicase Lymphoid-Specific, FLJ10339, Lymphoid Specific Helicase, LSH, Nbla10143, PASG, Proliferation-associated SNF2-like Protein, SWI/SNF2-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 6, SMARCA6) (MaxLight 650)
127792-ML650 100 µL

HELLS (Helicase Lymphoid-Specific, FLJ10339, Lymphoid Specific Helicase, LSH, Nbla10143, PASG, Proliferation-associated SNF2-like Protein, SWI/SNF2-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 6, SMARCA6) (MaxLight 650)

Sign In for Pricing
View Details
VDAC1, ID (Voltage-dependent Anion-selective Channel Protein 1, VDAC-1, hVDAC1, Outer Mitochondrial Membrane Protein Porin 1, Plasmalemmal Porin, Porin 31HL, Porin 31HM, VDAC) (APC) discontinued
V2121-20E-APC 200 µL

VDAC1, ID (Voltage-dependent Anion-selective Channel Protein 1, VDAC-1, hVDAC1, Outer Mitochondrial Membrane Protein Porin 1, Plasmalemmal Porin, Porin 31HL, Porin 31HM, VDAC) (APC) discontinued

Sign In for Pricing
View Details
EV450 Anti-Human CD8a Antibody [OKT-8]
MBS2568344-01 20 Tests

EV450 Anti-Human CD8a Antibody [OKT-8]

Sign In for Pricing
View Details
EV450 Anti-Human CD8a Antibody [OKT-8]
MBS2568344-02 100 Tests

EV450 Anti-Human CD8a Antibody [OKT-8]

Sign In for Pricing
View Details
EV450 Anti-Human CD8a Antibody [OKT-8]
MBS2568344-03 2x 100 Tests

EV450 Anti-Human CD8a Antibody [OKT-8]

Sign In for Pricing
View Details
EV450 Anti-Human CD8a Antibody [OKT-8]
MBS2568344-04 10x 100 Tests

EV450 Anti-Human CD8a Antibody [OKT-8]

Sign In for Pricing
View Details