Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC46A3 Rabbit Polyclonal Antibody (HRP)

SLC46A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FKSG16

UniProt

Q7Z3Q1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC46A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_861450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosine Hydroxylase (TH, TYH, Tyrosine 3 Hydroxylase, Tyrosine 3 Monooxygenase) (Biotin) discontinued
T9237-13-Biotin 100 µL

Tyrosine Hydroxylase (TH, TYH, Tyrosine 3 Hydroxylase, Tyrosine 3 Monooxygenase) (Biotin) discontinued

Sign In for Pricing
View Details
FAM118B Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2511953 100 µL

FAM118B Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Human Surfactant Associated Protein C ELISA Kit
MBS076726-01 48 Well

Human Surfactant Associated Protein C ELISA Kit

Sign In for Pricing
View Details
Human Surfactant Associated Protein C ELISA Kit
MBS076726-02 96 Well

Human Surfactant Associated Protein C ELISA Kit

Sign In for Pricing
View Details
Human Surfactant Associated Protein C ELISA Kit
MBS076726-03 5x 96 Well

Human Surfactant Associated Protein C ELISA Kit

Sign In for Pricing
View Details
Human Surfactant Associated Protein C ELISA Kit
MBS076726-04 10x 96 Well

Human Surfactant Associated Protein C ELISA Kit

Sign In for Pricing
View Details