Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc6a15 Rabbit Polyclonal Antibody (HRP)

Slc6a15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

V7-, v7-3, AA536730, AI326450, AI326451

UniProt

Q8BG16

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_780537

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL
BNC940418-100 1x 100 µL

Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) ELISA Kit
RD-CHRNb2-Hu-01 96 Tests

Human Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) ELISA Kit

Sign In for Pricing
View Details
Human Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) ELISA Kit
RD-CHRNb2-Hu-02 48 Tests

Human Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) ELISA Kit

Sign In for Pricing
View Details
OR8I2 Human Gene Knockout Kit (CRISPR)
KN422022 1 Kit

OR8I2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI8G6]
CF807180 100 µg

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI8G6]

Sign In for Pricing
View Details
Zotepine N,S-Dioxide
TRC-Z700915-50MG 50 mg

Zotepine N,S-Dioxide

Sign In for Pricing
View Details