Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc37a2 Rabbit Polyclonal Antibody (HRP)

Slc37a2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G3, ci, cI-, ci2, G3PP, Slc3, cI-2, Slc37a1

UniProt

Q9WU81

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064654

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal MSX1 antibody - N-terminal region
AMM06497G 0.1mg

Polyclonal MSX1 antibody - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal Follistatin Antibody (FST/4281) [Alexa Fluor 488]
NBP3-08813AF488 100 µL

Mouse Monoclonal Follistatin Antibody (FST/4281) [Alexa Fluor 488]

Sign In for Pricing
View Details
PrePack Q Purose 6 HP
MBS8579639-01 1 mL

PrePack Q Purose 6 HP

Sign In for Pricing
View Details
PrePack Q Purose 6 HP
MBS8579639-02 5 mL

PrePack Q Purose 6 HP

Sign In for Pricing
View Details
PrePack Q Purose 6 HP
MBS8579639-03 5x 1 mL

PrePack Q Purose 6 HP

Sign In for Pricing
View Details
Rabbit anti Horse IgG1 IgG2 IgA IgM (heavy and light chains)
MBS571303-01 1 mL

Rabbit anti Horse IgG1 IgG2 IgA IgM (heavy and light chains)

Sign In for Pricing
View Details