Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A35 Rabbit Polyclonal Antibody (FITC)

SLC25A35 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ40217, MGC120446, MGC120448

UniProt

Q3KQZ1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A35

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_958928

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhes, CT (RASD2, GTP-binding Protein Rhes, Ras Homolog Enriched in Striatum, Tumor Endothelial Marker 2, TEM2) (MaxLight 405)
MBS6270105-01 0.1 mL

Rhes, CT (RASD2, GTP-binding Protein Rhes, Ras Homolog Enriched in Striatum, Tumor Endothelial Marker 2, TEM2) (MaxLight 405)

Sign In for Pricing
View Details
Rhes, CT (RASD2, GTP-binding Protein Rhes, Ras Homolog Enriched in Striatum, Tumor Endothelial Marker 2, TEM2) (MaxLight 405)
MBS6270105-02 5x 0.1 mL

Rhes, CT (RASD2, GTP-binding Protein Rhes, Ras Homolog Enriched in Striatum, Tumor Endothelial Marker 2, TEM2) (MaxLight 405)

Sign In for Pricing
View Details
Gm12942 sgRNA CRISPR Lentivector set (Mouse)
K4859901 3x 1.0 µg

Gm12942 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Gtsf1l Pre-designed siRNA Set A
SI105954A 1 Each

Mouse Gtsf1l Pre-designed siRNA Set A

Sign In for Pricing
View Details
PLAGL1 Antibody (YA4575, Mouse)
HY-P84878-01 10 µL

PLAGL1 Antibody (YA4575, Mouse)

Sign In for Pricing
View Details
PLAGL1 Antibody (YA4575, Mouse)
HY-P84878-02 50 μL

PLAGL1 Antibody (YA4575, Mouse)

Sign In for Pricing
View Details