Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A35 Rabbit Polyclonal Antibody (HRP)

SLC25A35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SLC25A35

UniProt

Q3KQZ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SLC25A35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSST

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005256696

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNH, CT (CCNH, Cyclin-H, MO15-associated protein, p34, p37) (FITC)
MBS6282446-01 0.2 mL

CCNH, CT (CCNH, Cyclin-H, MO15-associated protein, p34, p37) (FITC)

Sign In for Pricing
View Details
CCNH, CT (CCNH, Cyclin-H, MO15-associated protein, p34, p37) (FITC)
MBS6282446-02 5x 0.2 mL

CCNH, CT (CCNH, Cyclin-H, MO15-associated protein, p34, p37) (FITC)

Sign In for Pricing
View Details
TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (HRP)
MBS6503690-01 0.2 mL

TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (HRP)

Sign In for Pricing
View Details
TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (HRP)
MBS6503690-02 5x 0.2 mL

TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (HRP)

Sign In for Pricing
View Details
CNL1GR 4 Die-cut & Printed Numbers & Letters
912186 250 Pack (10 Label (s) x 25 Card)

CNL1GR 4 Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details
C9orf80 CRISPR All-in-one AAV vector set (with saCas9)(Human)
14824151 3x 1.0 µg DNA

C9orf80 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details