Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPOR Rabbit Polyclonal Antibody (HRP)

EPOR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EPO-R

UniProt

P19235

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EPOR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_000112

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dtx3l Mouse shRNA Lentiviral Particle (Locus ID 209200)
TL506266V 500 µL Each

Dtx3l Mouse shRNA Lentiviral Particle (Locus ID 209200)

Sign In for Pricing
View Details
CYP2B9 Lentiviral Activation Particles (m2)
sc-419909-LAC-2 200 µL

CYP2B9 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Pira4 Double Nickase Plasmid (m)
sc-422247-NIC 20 µg

Pira4 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12)
MBS2082036-01 0.1 mL

HRP-Linked Polyclonal Antibody to DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12)
MBS2082036-02 0.2 mL

HRP-Linked Polyclonal Antibody to DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12)
MBS2082036-03 0.5 mL

HRP-Linked Polyclonal Antibody to DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12)

Sign In for Pricing
View Details