Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPOR Rabbit Polyclonal Antibody (HRP)

EPOR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EPO-R

UniProt

P19235

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EPOR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_000112

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR157, ID (GPR157, Probable G-protein coupled receptor 157) (MaxLight 405) discontinued
036230-ML405 100 µL

GPR157, ID (GPR157, Probable G-protein coupled receptor 157) (MaxLight 405) discontinued

Sign In for Pricing
View Details
C6orf118 Double Nickase Plasmid (h)
sc-414904-NIC 20 µg

C6orf118 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Cavy Glyoxalase I ELISA Kit
MBS094373 Inquire

Cavy Glyoxalase I ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Timm17a shRNA (UAS) - Lentiviral mouse Timm17a shRNA (UAS, GFP) plasmid
GTR15192502 1 Vial

Lentiviral mouse Timm17a shRNA (UAS) - Lentiviral mouse Timm17a shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SorLA Double Nickase Plasmid (m)
sc-423073-NIC 20 µg

SorLA Double Nickase Plasmid (m)

Sign In for Pricing
View Details
C-Src (H-12) Alexa Fluor® 790
sc-5266 AF790 200 µg/mL

C-Src (H-12) Alexa Fluor® 790

Sign In for Pricing
View Details