Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAA Rabbit Polyclonal Antibody (Biotin)

GAA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LYAG

UniProt

P10253

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GAA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARVCF Protein Vector (Human) (pPB-His-MBP)
PV324102 500 ng

ARVCF Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Rfc2 Rat shRNA Lentiviral Particle (Locus ID 116468)
TL712150V 500 µL Each

Rfc2 Rat shRNA Lentiviral Particle (Locus ID 116468)

Sign In for Pricing
View Details
Human SSBP3 (NM_145716) AAV Particle
RC209426A1V 250 µL

Human SSBP3 (NM_145716) AAV Particle

Sign In for Pricing
View Details
POU4F1 (POU Domain, Class 4, Transcription Factor 1, Brain Specific Homeobox/POU Domain Protein 3A, BRN3A, Brn-3a, Brn-3.0, Brn3, FLJ13449, Homeobox/POU Domain Protein RDC1, Oct-T1, RDC-1, FLJ13449) (MaxLight 550)
MBS6213284-01 0.1 mL

POU4F1 (POU Domain, Class 4, Transcription Factor 1, Brain Specific Homeobox/POU Domain Protein 3A, BRN3A, Brn-3a, Brn-3.0, Brn3, FLJ13449, Homeobox/POU Domain Protein RDC1, Oct-T1, RDC-1, FLJ13449) (MaxLight 550)

Sign In for Pricing
View Details
POU4F1 (POU Domain, Class 4, Transcription Factor 1, Brain Specific Homeobox/POU Domain Protein 3A, BRN3A, Brn-3a, Brn-3.0, Brn3, FLJ13449, Homeobox/POU Domain Protein RDC1, Oct-T1, RDC-1, FLJ13449) (MaxLight 550)
MBS6213284-02 5x 0.1 mL

POU4F1 (POU Domain, Class 4, Transcription Factor 1, Brain Specific Homeobox/POU Domain Protein 3A, BRN3A, Brn-3a, Brn-3.0, Brn3, FLJ13449, Homeobox/POU Domain Protein RDC1, Oct-T1, RDC-1, FLJ13449) (MaxLight 550)

Sign In for Pricing
View Details
OR51A1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1561606 1.0 µg DNA

OR51A1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details