Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAA Rabbit Polyclonal Antibody (FITC)

GAA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LYAG

UniProt

P10253

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence APTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRST

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: APTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRST

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

NCBI Accession Number

NP_000143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM48A (SUPT20H) Human Over-expression Lysate
orb1363048 20 µg

FAM48A (SUPT20H) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal FIP1L1 Antibody [Alexa Fluor 700]
NB100-74589AF700 0.1 mL

Rabbit Polyclonal FIP1L1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Cym CRISPR All-in-one AAV vector set (with saCas9)(Rat)
17305156 3x 1.0 µg DNA

Cym CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina Coenzyme PQQ synthesis protein E (pqqE)
MBS1028447-01 0.02 mg (E-Coli)

Recombinant Pseudomonas mendocina Coenzyme PQQ synthesis protein E (pqqE)

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina Coenzyme PQQ synthesis protein E (pqqE)
MBS1028447-02 0.02 mg (Yeast)

Recombinant Pseudomonas mendocina Coenzyme PQQ synthesis protein E (pqqE)

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina Coenzyme PQQ synthesis protein E (pqqE)
MBS1028447-03 0.1 mg (E-Coli)

Recombinant Pseudomonas mendocina Coenzyme PQQ synthesis protein E (pqqE)

Sign In for Pricing
View Details