Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sgcd Rabbit Polyclonal Antibody (Biotin)

Sgcd Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Sgcd

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTIWILKVMNFTIGNALYFKSARNVTVNILNDQTKVLTQLVTGPKAVEAY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein 1(MDR1) Mouse Monoclonal Antibody
BF8972-01 100 µL

P Glycoprotein 1(MDR1) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
P Glycoprotein 1(MDR1) Mouse Monoclonal Antibody
BF8972-02 200 µL

P Glycoprotein 1(MDR1) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MAX, Phosphorylated (pS11) (MYC Associated Factor X, MGC10775, MGC11225, MGC18164, MGC34679, MGC36767,bHLHd4,_+E_bHLHd5, bHLHd6, bHLHd7, bHLHd8, orf1) (Biotin)
MBS6426146-01 0.1 mL

MAX, Phosphorylated (pS11) (MYC Associated Factor X, MGC10775, MGC11225, MGC18164, MGC34679, MGC36767,bHLHd4,_+E_bHLHd5, bHLHd6, bHLHd7, bHLHd8, orf1) (Biotin)

Sign In for Pricing
View Details
MAX, Phosphorylated (pS11) (MYC Associated Factor X, MGC10775, MGC11225, MGC18164, MGC34679, MGC36767,bHLHd4,_+E_bHLHd5, bHLHd6, bHLHd7, bHLHd8, orf1) (Biotin)
MBS6426146-02 5x 0.1 mL

MAX, Phosphorylated (pS11) (MYC Associated Factor X, MGC10775, MGC11225, MGC18164, MGC34679, MGC36767,bHLHd4,_+E_bHLHd5, bHLHd6, bHLHd7, bHLHd8, orf1) (Biotin)

Sign In for Pricing
View Details
Anti-Annexin A1 Antibody [ABT-ANXA1]
MBS9510613-01 0.05 mL

Anti-Annexin A1 Antibody [ABT-ANXA1]

Sign In for Pricing
View Details
Anti-Annexin A1 Antibody [ABT-ANXA1]
MBS9510613-02 0.1 mL

Anti-Annexin A1 Antibody [ABT-ANXA1]

Sign In for Pricing
View Details