Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sgcd Rabbit Polyclonal Antibody (FITC)

Sgcd Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Sgcd

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MTIWILKVMNFTIGNALYFKSARNVTVNILNDQTKVLTQLVTGPKAVEAY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RALY Human shRNA Lentiviral Particle (Locus ID 22913)
TL309952V 500 µL Each

RALY Human shRNA Lentiviral Particle (Locus ID 22913)

Sign In for Pricing
View Details
PP4R2 CRISPR/Cas9 KO Plasmid (m)
sc-433154 20 µg

PP4R2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Rer1 Double Nickase Plasmid (h)
sc-411562-NIC 20 µg

Rer1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
UEVLD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV716608 1.0 µg DNA

UEVLD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human WW Domain-Binding Protein 2 Recombinant Protein N-6 His Tag Lyophilized
MBS8433778-01 0.05 mg

Human WW Domain-Binding Protein 2 Recombinant Protein N-6 His Tag Lyophilized

Sign In for Pricing
View Details
Human WW Domain-Binding Protein 2 Recombinant Protein N-6 His Tag Lyophilized
MBS8433778-02 5x 0.05 mg

Human WW Domain-Binding Protein 2 Recombinant Protein N-6 His Tag Lyophilized

Sign In for Pricing
View Details