Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psen2 Rabbit Polyclonal Antibody (Biotin)

Psen2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O88777

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psen2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)
MBS1252199-01 0.02 mg (E-Coli)

Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)

Sign In for Pricing
View Details
Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)
MBS1252199-02 0.02 mg (Yeast)

Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)

Sign In for Pricing
View Details
Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)
MBS1252199-03 0.1 mg (E-Coli)

Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)

Sign In for Pricing
View Details
Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)
MBS1252199-04 0.1 mg (Yeast)

Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)

Sign In for Pricing
View Details
Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)
MBS1252199-05 0.02 mg (Baculovirus)

Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)

Sign In for Pricing
View Details
Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)
MBS1252199-06 0.02 mg (Mammalian-Cell)

Recombinant Drosophila erecta E3 ubiquitin-protein ligase sina (sina)

Sign In for Pricing
View Details