Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QB Rabbit Polyclonal Antibody (FITC)

C1QB Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P02746

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C1QB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_000482

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC3 siRNA (Human)
MBS8207134-01 15 nmol

ZDHHC3 siRNA (Human)

Sign In for Pricing
View Details
ZDHHC3 siRNA (Human)
MBS8207134-02 30 nmol

ZDHHC3 siRNA (Human)

Sign In for Pricing
View Details
ZDHHC3 siRNA (Human)
MBS8207134-03 5x 30 nmol

ZDHHC3 siRNA (Human)

Sign In for Pricing
View Details
Platelet-activating Factor acetylhydrolase IB subunit gamma (PAFAH1B3) Bovine ELISA Kit
F9500 96 Tests

Platelet-activating Factor acetylhydrolase IB subunit gamma (PAFAH1B3) Bovine ELISA Kit

Sign In for Pricing
View Details
RBAK, NT (RBAK, ZNF769, RB-associated KRAB zinc finger protein, RB-associated KRAB repressor, Zinc finger protein 769) (MaxLight 405)
MBS6340602-01 0.1 mL

RBAK, NT (RBAK, ZNF769, RB-associated KRAB zinc finger protein, RB-associated KRAB repressor, Zinc finger protein 769) (MaxLight 405)

Sign In for Pricing
View Details
RBAK, NT (RBAK, ZNF769, RB-associated KRAB zinc finger protein, RB-associated KRAB repressor, Zinc finger protein 769) (MaxLight 405)
MBS6340602-02 5x 0.1 mL

RBAK, NT (RBAK, ZNF769, RB-associated KRAB zinc finger protein, RB-associated KRAB repressor, Zinc finger protein 769) (MaxLight 405)

Sign In for Pricing
View Details