Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGG Rabbit Polyclonal Antibody (FITC)

FGG Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q53Y18

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FGG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG

Field of Research

Cardiovascular Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COT2 Antibody
8C10471-AAT 50 µg

COT2 Antibody

Sign In for Pricing
View Details
Pigg Mouse Gene Knockout Kit (CRISPR)
KN513268 1 Kit

Pigg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CTNNA3 (NM_013266) Human Recombinant Protein
TP313265L 1 mg

CTNNA3 (NM_013266) Human Recombinant Protein

Sign In for Pricing
View Details
CD74 (CLIP/813), CF405S conjugate, 0.1mg/mL
BNC040813-500 1x 500 µL

CD74 (CLIP/813), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Cecum
CB506137 1 Block

Frozen Tissue Blocks, Cecum

Sign In for Pricing
View Details
Human Protein cornichon homolog 2 (CNIH2) activation kit by CRISPRa
GA116780 1 Kit

Human Protein cornichon homolog 2 (CNIH2) activation kit by CRISPRa

Sign In for Pricing
View Details