Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyrp1 Rabbit Polyclonal Antibody (HRP)

Tyrp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B

UniProt

D3ZH71

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001100134

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dylight 350 Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-
DY350-6301-1 1 mg

Dylight 350 Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-

Sign In for Pricing
View Details
Phosphotyrosine 7x sampler kit (incl. pos. control) Mouse Polyclonal Antibody
AM00129PU-N 7x 25 µg

Phosphotyrosine 7x sampler kit (incl. pos. control) Mouse Polyclonal Antibody

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1700006A11Rik Mouse Gene Knockout Kit (CRISPR)
KN500062 1 Kit

1700006A11Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Plaur Mouse Gene Knockout Kit (CRISPR)
KN313408LP 1 Kit

Plaur Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Magic Red® Fluorescent Cathepsin B Assay Kit
938 100 Tests

Magic Red® Fluorescent Cathepsin B Assay Kit

Sign In for Pricing
View Details