Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp4b Rabbit Polyclonal Antibody (HRP)

Atp4b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S76401S1

UniProt

P18598

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036642

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin-10 Receptor Subunit Beta, IL10RB Primacu™ ELISA Kit
BPE160-01 96 Tests

Human Interleukin-10 Receptor Subunit Beta, IL10RB Primacu™ ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-10 Receptor Subunit Beta, IL10RB Primacu™ ELISA Kit
BPE160-02 5x 96 Tests

Human Interleukin-10 Receptor Subunit Beta, IL10RB Primacu™ ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-10 Receptor Subunit Beta, IL10RB Primacu™ ELISA Kit
BPE160-03 15x 96 Tests

Human Interleukin-10 Receptor Subunit Beta, IL10RB Primacu™ ELISA Kit

Sign In for Pricing
View Details
EFCAB5 Adenovirus (Mouse)
18998054 1.0 mL

EFCAB5 Adenovirus (Mouse)

Sign In for Pricing
View Details
Mucin 15 CRISPR/Cas9 KO Plasmid (m)
sc-435329 20 µg

Mucin 15 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human HCLS1 sgRNA gene knockout kit - Lentiviral human HCLS1 sgRNA gene knockout kit (plasmid)
GTR15358964 1 Vial

Lentiviral human HCLS1 sgRNA gene knockout kit - Lentiviral human HCLS1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details