Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EG546729 Rabbit Polyclonal Antibody (HRP)

EG546729 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EG546729

UniProt

D3Z291

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GITDQGTMNRLLTSWHKCKPPLRLGQEAPLMSNGWAGGEPRPPRKEVATY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001074740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Docusate Calcium
447614-01 100 mg

Docusate Calcium

Sign In for Pricing
View Details
Docusate Calcium
447614-02 250 mg

Docusate Calcium

Sign In for Pricing
View Details
Recombinant Escherichia coli Cardiolipin synthase (cls), partial
MBS7054468 Inquire

Recombinant Escherichia coli Cardiolipin synthase (cls), partial

Sign In for Pricing
View Details
Rabbit Polyclonal Mas Antibody
NBP3-17188-100ul 100 µL

Rabbit Polyclonal Mas Antibody

Sign In for Pricing
View Details
MYPT1, phosphorylated (Thr696) (Myosin Phosphatase Target Subunit 1, Myosin Phosphatase-targeting Subunit 1, MBS, MGC133042, Protein Phosphatase 1 Regulatory Subunit 12A, PPP1R12A, Protein Phosphatase Myosin-binding Subunit)
MBS6004571-01 0.1 mL

MYPT1, phosphorylated (Thr696) (Myosin Phosphatase Target Subunit 1, Myosin Phosphatase-targeting Subunit 1, MBS, MGC133042, Protein Phosphatase 1 Regulatory Subunit 12A, PPP1R12A, Protein Phosphatase Myosin-binding Subunit)

Sign In for Pricing
View Details
MYPT1, phosphorylated (Thr696) (Myosin Phosphatase Target Subunit 1, Myosin Phosphatase-targeting Subunit 1, MBS, MGC133042, Protein Phosphatase 1 Regulatory Subunit 12A, PPP1R12A, Protein Phosphatase Myosin-binding Subunit)
MBS6004571-02 5x 0.1 mL

MYPT1, phosphorylated (Thr696) (Myosin Phosphatase Target Subunit 1, Myosin Phosphatase-targeting Subunit 1, MBS, MGC133042, Protein Phosphatase 1 Regulatory Subunit 12A, PPP1R12A, Protein Phosphatase Myosin-binding Subunit)

Sign In for Pricing
View Details