Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM6SF2 Rabbit Polyclonal Antibody (FITC)

TM6SF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9BZW4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TM6SF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Calpain 12 (CAPN12) activation kit by CRISPRa
GA115645 1 Kit

Human Calpain 12 (CAPN12) activation kit by CRISPRa

Sign In for Pricing
View Details
Stool Nucleic Acid Collection and Preservation Devices Dx
Dx45660 50 Devices

Stool Nucleic Acid Collection and Preservation Devices Dx

Sign In for Pricing
View Details
Recombinant Mouse TGFBR2 Protein (Fc Tag)
PKSM041170-01 10 µg

Recombinant Mouse TGFBR2 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse TGFBR2 Protein (Fc Tag)
PKSM041170-02 50 µg

Recombinant Mouse TGFBR2 Protein (Fc Tag)

Sign In for Pricing
View Details
HTR2B Rabbit Polyclonal Antibody
AP01188PU-N 100 µg

HTR2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS632885 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details