Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM6SF2 Rabbit Polyclonal Antibody (FITC)

TM6SF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9BZW4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TM6SF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bak (BAK1) (NM_001188) Human Over-expression Lysate
LY400476 100 µg

Bak (BAK1) (NM_001188) Human Over-expression Lysate

Sign In for Pricing
View Details
Sponge Hsp70 Mouse Monoclonal Antibody [Clone ID: IVF5]
AM02038PU-N 100 µg

Sponge Hsp70 Mouse Monoclonal Antibody [Clone ID: IVF5]

Sign In for Pricing
View Details
HA tag, AlpHcAbs® Rabbit antibody (Biotin)
HA710115 100 µg

HA tag, AlpHcAbs® Rabbit antibody (Biotin)

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR561704 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
CBX8 (Center) Rabbit Polyclonal Antibody
AP50746PU-N 400 µL

CBX8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCIP RED, 100 mg
#10004 1x 100 mg

BCIP RED, 100 mg

Sign In for Pricing
View Details