Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1B1 Rabbit Polyclonal Antibody (HRP)

ATP1B1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATP1B

UniProt

P05026

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATP1B1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CRELD1 Antibody [CoraFluor 1]
NBP2-98393CL1 0.1 mL

Rabbit Polyclonal CRELD1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Tagged ORF Clone Lentiviral Particle
RC206523L1V 200 µL

Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TBKB1 (N-term) Rabbit Polyclonal Antibody
E10G30667 100 µL

TBKB1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat D-Dimer (D2D) ELISA Kit
DLR-D2D-Ra-96T 96 Tests

Rat D-Dimer (D2D) ELISA Kit

Sign In for Pricing
View Details
SLC41A1 Human shRNA Lentiviral Particle (Locus ID 254428)
TL301567V 500 µL Each

SLC41A1 Human shRNA Lentiviral Particle (Locus ID 254428)

Sign In for Pricing
View Details
Anti-Zebrafish DLX2A Antibody Picoband® Fluoro647 Conjugated
AZP50574-Fluoro647 100 µg/Vial

Anti-Zebrafish DLX2A Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details