Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMH4 Rabbit Polyclonal Antibody (HRP)

ARMH4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UT2, C14orf37, c14_5376

UniProt

Q86TY3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf37

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIAHVHAEKGQSDKMNTDDLENSSVTSKQTPQLVVSEDPMMMSAVPSATS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001872

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fanci sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4720205 3x 1.0 µg

Fanci sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
2-Chloro-3- (methylsulfanyl) phenylboronic acid
OR1088079 1 Each

2-Chloro-3- (methylsulfanyl) phenylboronic acid

Sign In for Pricing
View Details
MPM-AIRINVENT-200MMX30M-WT/RD/WT-ROLL Pipe Markers for Air & Ducts
310561 1 Pack (1 Roll x 1 Roll)

MPM-AIRINVENT-200MMX30M-WT/RD/WT-ROLL Pipe Markers for Air & Ducts

Sign In for Pricing
View Details
HA Protein (C-mouse IgG1-Fc & His, H5N1)
P525073 100 µg

HA Protein (C-mouse IgG1-Fc & His, H5N1)

Sign In for Pricing
View Details
Etfdh sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3476105 3x 1.0 µg

Etfdh sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
IFI27L1 Protein Vector (Mouse) (pPM-C-HA)
PV190644 500 ng

IFI27L1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details