Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFYVE27 Rabbit Polyclonal Antibody (HRP)

ZFYVE27 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPG33, PROTRUDIN

UniProt

Q5T4F4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZFYVE27

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001002261

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF647 conjugate, 0.1mg/mL
BNC470287-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LOC340450 Human qPCR Primer Pair (XM_295252)
HP221623 200 Reactions

LOC340450 Human qPCR Primer Pair (XM_295252)

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FHL2 Mouse Monoclonal Antibody [Clone ID: 11-134]
AM20016AF-N 100 µg

FHL2 Mouse Monoclonal Antibody [Clone ID: 11-134]

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF740 conjugate, 0.1mg/mL
BNC742097-100 1x 100 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Parvulin-14/PIN4 Protein (His Tag)
PKSH032859-01 10 µg

Recombinant Human Parvulin-14/PIN4 Protein (His Tag)

Sign In for Pricing
View Details