Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR177 Rabbit Polyclonal Antibody (HRP)

GPR177 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVI, MRP, GPR177, mig-14, C1orf139

UniProt

Q96IV8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GPR177

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAH07211

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Gastric Lipase Antibody [Alexa Fluor 532]
NBP2-97088AF532 0.1 mL

Rabbit Polyclonal Gastric Lipase Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
OR8L1P Protein Lysate (Human) with C-Ha Tag
35686031 100 µg

OR8L1P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Olr1241 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
33773156 3x 1.0 µg DNA

Olr1241 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
HRSP12 ORF Vector (Human) (pORF)
23906011 1.0 µg DNA

HRSP12 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IFABP Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62307R-PE-Cy5.5 100 µL

IFABP Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
1- (5-Chlorobenzo[d]thiazol-2-yl) piperidine-4-carboxylic acid
OR322739 1 Each

1- (5-Chlorobenzo[d]thiazol-2-yl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details