Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR177 Rabbit Polyclonal Antibody (Biotin)

GPR177 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EVI, MRP, GPR177, mig-14, C1orf139

UniProt

Q5T9L3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR177

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001002292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Leptospira Biflexa DnaA Protein (aa 1-441)
VAng-Wyb0034-50gEcoli 50 µg (E. coli)

Recombinant Leptospira Biflexa DnaA Protein (aa 1-441)

Sign In for Pricing
View Details
NCKPL, ID (NCKAP1L, HEM1, Nck-associated protein 1-like, Hematopoietic protein 1, Membrane-associated protein HEM-1) (APC) discontinued
038832-APC 200 µL

NCKPL, ID (NCKAP1L, HEM1, Nck-associated protein 1-like, Hematopoietic protein 1, Membrane-associated protein HEM-1) (APC) discontinued

Sign In for Pricing
View Details
TFAP2C Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46558065 1.0 µg DNA

TFAP2C Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
AARS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0015608 1.0 µg DNA

AARS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral human ZNF280D shRNA (UAS) - Lentiviral human ZNF280D shRNA (UAS, RFP) plasmid
GTR15102325 1 Vial

Lentiviral human ZNF280D shRNA (UAS) - Lentiviral human ZNF280D shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
AKT1 Antibody (Phospho-Thr450) : FITC (OAAF00070-FITC)
OAAF00070-100UG-FITC 100 µg

AKT1 Antibody (Phospho-Thr450) : FITC (OAAF00070-FITC)

Sign In for Pricing
View Details