Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR177 Rabbit Polyclonal Antibody (HRP)

GPR177 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVI, MRP, GPR177, mig-14, C1orf139

UniProt

Q5T9L3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR177

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001002292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Recombinant Protein
TP311377M 100 µg

Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Recombinant Protein

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2979R), 0.2mg/mL
BNUB2979-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/2979R), 0.2mg/mL

Sign In for Pricing
View Details
DCTN4 (NM_001135643) Human Over-expression Lysate
LC427644 20 µg

DCTN4 (NM_001135643) Human Over-expression Lysate

Sign In for Pricing
View Details
APOBEC4 Mouse Monoclonal Antibody [Clone ID: OTI3F11]
CF810779 100 µg

APOBEC4 Mouse Monoclonal Antibody [Clone ID: OTI3F11]

Sign In for Pricing
View Details
RPL31 (NM_000993) Human Over-expression Lysate
LY424405 100 µg

RPL31 (NM_000993) Human Over-expression Lysate

Sign In for Pricing
View Details
GALK2 Polyclonal Antibody
E-AB-19049-01 20 µL

GALK2 Polyclonal Antibody

Sign In for Pricing
View Details