Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJB12 Rabbit Polyclonal Antibody (HRP)

DNAJB12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DJ10

UniProt

Q9NXW2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DNAJB12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001002762

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis A Virus VP1-P2A (722-830 a.a.) Recombinant (HAV VP1-P2A (722-830 a.a.) )
PT_40809-01 100 µg

Hepatitis A Virus VP1-P2A (722-830 a.a.) Recombinant (HAV VP1-P2A (722-830 a.a.) )

Sign In for Pricing
View Details
Hepatitis A Virus VP1-P2A (722-830 a.a.) Recombinant (HAV VP1-P2A (722-830 a.a.) )
PT_40809-02 500 µg

Hepatitis A Virus VP1-P2A (722-830 a.a.) Recombinant (HAV VP1-P2A (722-830 a.a.) )

Sign In for Pricing
View Details
Hepatitis A Virus VP1-P2A (722-830 a.a.) Recombinant (HAV VP1-P2A (722-830 a.a.) )
PT_40809-03 1000 µg

Hepatitis A Virus VP1-P2A (722-830 a.a.) Recombinant (HAV VP1-P2A (722-830 a.a.) )

Sign In for Pricing
View Details
Stem Cell Growth Factor beta (SCGFb) (MaxLight 750)
MBS6501142-01 0.1 mL

Stem Cell Growth Factor beta (SCGFb) (MaxLight 750)

Sign In for Pricing
View Details
Stem Cell Growth Factor beta (SCGFb) (MaxLight 750)
MBS6501142-02 5x 0.1 mL

Stem Cell Growth Factor beta (SCGFb) (MaxLight 750)

Sign In for Pricing
View Details
RHEB (GTP-binding Protein Rheb, Ras Homolog Enriched in Brain, RHEB2, MGC111559) (MaxLight 650)
132549-ML650 100 µL

RHEB (GTP-binding Protein Rheb, Ras Homolog Enriched in Brain, RHEB2, MGC111559) (MaxLight 650)

Sign In for Pricing
View Details