Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf21 Rabbit Polyclonal Antibody (HRP)

C6orf21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G6f, NG32, LY6G6, LY6G6D, C6orf21

UniProt

B0UXB7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C6orf21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001003693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (KRTL/1077), 1mg/mL
BNUM1077-50 1x 50 µL

Cytokeratin, LMW (KRTL/1077), 1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215M-01 20 Tests

Elab Fluor® 647 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215M-02 100 Tests

Elab Fluor® 647 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
Cap1 Rabbit Polyclonal Antibody
TA363003 100 µL

Cap1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ferritin Conjugated Glycine max Lectin (Soybean) -SBA-
I-1301-1 1 mg

Ferritin Conjugated Glycine max Lectin (Soybean) -SBA-

Sign In for Pricing
View Details