Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM220 Rabbit Polyclonal Antibody (HRP)

TMEM220 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TMEM220

UniProt

Q6QAJ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TMEM220

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LASYLLHRTQQNILHEEEGRELSGLVIITAWIILCHSSSKNPVGGRIQLA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]
TA504763AM 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF740 conjugate, 0.1mg/mL
BNC742818-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MON1A Rabbit Polyclonal Antibody
TA378600 100 µL

MON1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Prefoldin Subunit 1 (PFDN1) ELISA Kit
RD-PFDN1-Hu-01 96 Tests

Human Prefoldin Subunit 1 (PFDN1) ELISA Kit

Sign In for Pricing
View Details
Human Prefoldin Subunit 1 (PFDN1) ELISA Kit
RD-PFDN1-Hu-02 48 Tests

Human Prefoldin Subunit 1 (PFDN1) ELISA Kit

Sign In for Pricing
View Details
Cystathionase (CTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]
TA502443AM 100 µL

Cystathionase (CTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]

Sign In for Pricing
View Details