Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LINGO4 Rabbit Polyclonal Antibody (FITC)

LINGO4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LRRN6D, DAAT9248, PRO34002

UniProt

Q6UY18

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LINGO4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004432

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BACE1 / ASP2 Protein (His tag)
ARP7659-01 10 µg

Recombinant Human BACE1 / ASP2 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human BACE1 / ASP2 Protein (His tag)
ARP7659-02 50 µg

Recombinant Human BACE1 / ASP2 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human BACE1 / ASP2 Protein (His tag)
ARP7659-03 100 µg

Recombinant Human BACE1 / ASP2 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human BACE1 / ASP2 Protein (His tag)
ARP7659-04 1 mg

Recombinant Human BACE1 / ASP2 Protein (His tag)

Sign In for Pricing
View Details
CD8 (Leu-2, Lyt2, Lyt3, Tp32, T8) (PE/Texas Red) discontinued
228166 100 Tests

CD8 (Leu-2, Lyt2, Lyt3, Tp32, T8) (PE/Texas Red) discontinued

Sign In for Pricing
View Details
Anti-LSP1 Antibody Picoband®, Dylight550 Conjugate
A02992-2-Dylight550 100 µg

Anti-LSP1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details