Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC52 Rabbit Polyclonal Antibody (Biotin)

LRRC52 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8N7C0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human LRC52

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IANNPHLLSLHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLFL

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005214

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-c-Kit (Tyr568/570) Antibody
CST 48347S 100 µL

Phospho-c-Kit (Tyr568/570) Antibody

Sign In for Pricing
View Details
LDB3 (LIM Domain-binding Protein 3, Protein Cypher, Z-band Alternatively Spliced PDZ-motif Protein, KIAA0613, ZASP, FLJ35865, KIAA01613, LDB3Z1, LDB3Z4) (APC)
MBS6400978-01 0.1 mL

LDB3 (LIM Domain-binding Protein 3, Protein Cypher, Z-band Alternatively Spliced PDZ-motif Protein, KIAA0613, ZASP, FLJ35865, KIAA01613, LDB3Z1, LDB3Z4) (APC)

Sign In for Pricing
View Details
LDB3 (LIM Domain-binding Protein 3, Protein Cypher, Z-band Alternatively Spliced PDZ-motif Protein, KIAA0613, ZASP, FLJ35865, KIAA01613, LDB3Z1, LDB3Z4) (APC)
MBS6400978-02 5x 0.1 mL

LDB3 (LIM Domain-binding Protein 3, Protein Cypher, Z-band Alternatively Spliced PDZ-motif Protein, KIAA0613, ZASP, FLJ35865, KIAA01613, LDB3Z1, LDB3Z4) (APC)

Sign In for Pricing
View Details
Recombinant Human FERMT2 Protein, N-His-SUMO & C-Strep
bs-103390P-01 20 µg

Recombinant Human FERMT2 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Recombinant Human FERMT2 Protein, N-His-SUMO & C-Strep
bs-103390P-02 50 µg

Recombinant Human FERMT2 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Non-sterile Hydrophilic PVDF Vent Filters (injection molding), 0.1 (μm), 50 (mm), 25pcs/pk
11068227 25 Pieces

Non-sterile Hydrophilic PVDF Vent Filters (injection molding), 0.1 (μm), 50 (mm), 25pcs/pk

Sign In for Pricing
View Details