Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTYH1 Rabbit Polyclonal Antibody (Biotin)

TTYH1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9H313

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TTYH1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas Aeruginosa rplP Protein (aa 1-137) (strain LESB58)
VAng-Cr0351-500gEcoli 500 µg (E. coli)

Recombinant Pseudomonas Aeruginosa rplP Protein (aa 1-137) (strain LESB58)

Sign In for Pricing
View Details
HiPer® Ouchterlony Double Diffusion Teaching Kit (For Antibody Titration)
HTI003-15PR 15 Preparations

HiPer® Ouchterlony Double Diffusion Teaching Kit (For Antibody Titration)

Sign In for Pricing
View Details
Early E3 18.5 kDa glycoprotein Antibody
MBS9018695-01 0.05 mL

Early E3 18.5 kDa glycoprotein Antibody

Sign In for Pricing
View Details
Early E3 18.5 kDa glycoprotein Antibody
MBS9018695-02 0.1 mL

Early E3 18.5 kDa glycoprotein Antibody

Sign In for Pricing
View Details
Early E3 18.5 kDa glycoprotein Antibody
MBS9018695-03 5x 0.1 mL

Early E3 18.5 kDa glycoprotein Antibody

Sign In for Pricing
View Details
ACE Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0439R-BF647-01 20 µL

ACE Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details