Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT2 Rabbit Polyclonal Antibody (HRP)

B4GALT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B4Gal-T2, B4Gal-T3, beta4Gal-T2

UniProt

O60909

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human B4GALT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2672), CF647 conjugate, 0.1mg/mL
BNC472672-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2672), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COMT Human Knockdown Lysate
LY300121 100 µg

COMT Human Knockdown Lysate

Sign In for Pricing
View Details
POLR1C (NM_203290) Human Recombinant Protein
TP303486 20 µg

POLR1C (NM_203290) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS803860 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
IFNG Polyclonal Antibody
E-AB-70347-01 60 µL

IFNG Polyclonal Antibody

Sign In for Pricing
View Details
IFNG Polyclonal Antibody
E-AB-70347-02 120 µL

IFNG Polyclonal Antibody

Sign In for Pricing
View Details