Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT2 Rabbit Polyclonal Antibody (FITC)

B4GALT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B4Gal-T2, B4Gal-T3, beta4Gal-T2

UniProt

O60909

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human B4GALT2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Leukotriene B4 Receptor 2 Antibody
NBP1-89960-25ul 25 µL

Rabbit Polyclonal Leukotriene B4 Receptor 2 Antibody

Sign In for Pricing
View Details
SEPTIN12 Human Gene Knockout Kit (CRISPR)
KN407655 1 Kit

SEPTIN12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Copeptin (CPP) Mouse ELISA Kit
C5780 96 Tests

Copeptin (CPP) Mouse ELISA Kit

Sign In for Pricing
View Details
Canine CCSA-3 ELISA Kit
ECC0717 96 Tests

Canine CCSA-3 ELISA Kit

Sign In for Pricing
View Details
Recombinant JEV NS1/Non-structural protein 1 Protein, N-TrxA-His & C-His
YVV25801 100 μg

Recombinant JEV NS1/Non-structural protein 1 Protein, N-TrxA-His & C-His

Sign In for Pricing
View Details
Galectin 8 (LGALS8) Rabbit Polyclonal Antibody
TA314153 100 µL

Galectin 8 (LGALS8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details