Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C75 Rabbit Polyclonal Antibody (HRP)

OR6C75 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NL08

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OR6C75

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005497

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican 3 Recombinant Antibody, PE-Cy7 Conjugated
bsm-60006R-PE-Cy7 100 µL

Glypican 3 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
STAT3 mouse monoclonal antibody
E12-477 100 µg -100 µL

STAT3 mouse monoclonal antibody

Sign In for Pricing
View Details
GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated Serine Esterase 3), CTLA3, HFSP) (PE)
246882-PE 100 µL

GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated Serine Esterase 3), CTLA3, HFSP) (PE)

Sign In for Pricing
View Details
ANKRD44 Lentiviral Activation Particles (m2)
sc-435932-LAC-2 200 µL

ANKRD44 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
AHSP Rabbit Polyclonal Antibody (HRP)
orb467570 100 µL

AHSP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
NAP1L6 CRISPR Knock Out 293T Cell Line (Human)
31449141 1x 10^6 Cells / 1.0 mL

NAP1L6 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details