Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C70 Rabbit Polyclonal Antibody (HRP)

OR6C70 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NIJ9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR6C70

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM4B Recombinant Rabbit Monoclonal Antibody [JE36-58]
HA721350 100 µL

KDM4B Recombinant Rabbit Monoclonal Antibody [JE36-58]

Sign In for Pricing
View Details
ARHGEF4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E5]
TA812765AM 100 µL

ARHGEF4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E5]

Sign In for Pricing
View Details
Zfp472 Mouse Gene Knockout Kit (CRISPR)
KN519852 1 Kit

Zfp472 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat sIgA (Secretory Immunoglobulin A) ELISA Kit
E-EL-R0875-01 24 Tests

Rat sIgA (Secretory Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Rat sIgA (Secretory Immunoglobulin A) ELISA Kit
E-EL-R0875-02 48 Tests

Rat sIgA (Secretory Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Rat sIgA (Secretory Immunoglobulin A) ELISA Kit
E-EL-R0875-03 96 Tests

Rat sIgA (Secretory Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details