Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eda Rabbit Polyclonal Antibody (HRP)

Eda Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tnlg7c, RGD1563178

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Eda

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_002727621

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBXD3 (UBXN10) Mouse Monoclonal Antibody [Clone ID: OTI1H5]
TA501494 100 µL

UBXD3 (UBXN10) Mouse Monoclonal Antibody [Clone ID: OTI1H5]

Sign In for Pricing
View Details
2,3,5-Tri-O-benzyl-1-a-D-arabinofuranosyl chloride
MT71647-01 100 g

2,3,5-Tri-O-benzyl-1-a-D-arabinofuranosyl chloride

Sign In for Pricing
View Details
2,3,5-Tri-O-benzyl-1-a-D-arabinofuranosyl chloride
MT71647-02 250 g

2,3,5-Tri-O-benzyl-1-a-D-arabinofuranosyl chloride

Sign In for Pricing
View Details
Trove2 Rat shRNA Plasmid (Locus ID 304833)
TR705754 1 Kit

Trove2 Rat shRNA Plasmid (Locus ID 304833)

Sign In for Pricing
View Details
MICAL1 3'UTR Luciferase Stable Cell Line
TU013344 1.0 mL

MICAL1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
(Z) -4-Hydroxytamoxifen
FH24133-01 5 mg

(Z) -4-Hydroxytamoxifen

Sign In for Pricing
View Details