Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP8B2 Rabbit Polyclonal Antibody (Biotin)

ATP8B2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ATPID

UniProt

P98198

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ATP8B2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fibroblast Growth Factor 21 (FGF21) Antibody Pair Kit (with Standard)
MBS2102155-01 5x 96 Tests

Rat Fibroblast Growth Factor 21 (FGF21) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 21 (FGF21) Antibody Pair Kit (with Standard)
MBS2102155-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Fibroblast Growth Factor 21 (FGF21) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 21 (FGF21) Antibody Pair Kit (with Standard)
MBS2102155-03 10x 96 Tests

Rat Fibroblast Growth Factor 21 (FGF21) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 21 (FGF21) Antibody Pair Kit (with Standard)
MBS2102155-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Fibroblast Growth Factor 21 (FGF21) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
ZBTB16 (Zinc Finger and BTB Domain-containing Protein 16, PLZF, ZBTB 16, Zfp145, Znf145)
353332 100 µg

ZBTB16 (Zinc Finger and BTB Domain-containing Protein 16, PLZF, ZBTB 16, Zfp145, Znf145)

Sign In for Pricing
View Details
SQSTM1/p62 Rabbit Monoclonal Antibody
AMRe03796-01 1 Each

SQSTM1/p62 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details