Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP8B2 Rabbit Polyclonal Antibody (HRP)

ATP8B2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATPID

UniProt

P98198

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ATP8B2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TPD52L2 Protein, N-His
orb2833776-01 20 µg

Recombinant Human TPD52L2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TPD52L2 Protein, N-His
orb2833776-02 50 µg

Recombinant Human TPD52L2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TPD52L2 Protein, N-His
orb2833776-03 100 µg

Recombinant Human TPD52L2 Protein, N-His

Sign In for Pricing
View Details
RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (Biotin)
MBS6392003-01 0.1 mL

RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (Biotin)

Sign In for Pricing
View Details
RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (Biotin)
MBS6392003-02 5x 0.1 mL

RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (Biotin)

Sign In for Pricing
View Details
PRCC/Papillary renal cell carcinoma Rabbit Polyclonal Antibody (BF350)
orb2457523 100 µL

PRCC/Papillary renal cell carcinoma Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details