Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP8B2 Rabbit Polyclonal Antibody (HRP)

ATP8B2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATPID

UniProt

P98198

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ATP8B2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT2 Recombinant Protein (Rat)
RP211571 100 µg

MGAT2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
CAPN9 (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (MaxLight 405)
MBS6189221-01 0.1 mL

CAPN9 (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (MaxLight 405)

Sign In for Pricing
View Details
CAPN9 (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (MaxLight 405)
MBS6189221-02 5x 0.1 mL

CAPN9 (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (MaxLight 405)

Sign In for Pricing
View Details
ZRSR2 Recombinant Protein (Mouse)
RP188309 100 µg

ZRSR2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
MV hemagglutinin glycoprotein Polyclonal Antibody Bio Conjugated
MBS9462357-01 0.1 mL

MV hemagglutinin glycoprotein Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
MV hemagglutinin glycoprotein Polyclonal Antibody Bio Conjugated
MBS9462357-02 5x 0.1 mL

MV hemagglutinin glycoprotein Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details