Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDPN Rabbit Polyclonal Antibody (HRP)

PDPN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

T1A, GP36, GP40, Gp38, OTS8, T1A2, TI1A, T1A-2, AGGRUS, HT1A-1, PA2.26

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PDPN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_006465

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD51/ITGAV & ITGB6 Antibody (6.2B10), FITC
FMC21921 100 Tests

Anti-Mouse CD51/ITGAV & ITGB6 Antibody (6.2B10), FITC

Sign In for Pricing
View Details
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)
MBS1432393-01 0.02 mg (E-Coli)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)

Sign In for Pricing
View Details
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)
MBS1432393-02 0.02 mg (Yeast)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)

Sign In for Pricing
View Details
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)
MBS1432393-03 0.1 mg (E-Coli)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)

Sign In for Pricing
View Details
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)
MBS1432393-04 0.1 mg (Yeast)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)

Sign In for Pricing
View Details
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)
MBS1432393-05 0.02 mg (Baculovirus)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 7 (C1qtnf7)

Sign In for Pricing
View Details