Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDPN Rabbit Polyclonal Antibody (Biotin)

PDPN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

T1A, GP36, GP40, Gp38, OTS8, T1A2, TI1A, T1A-2, AGGRUS, HT1A-1, PA2.26

UniProt

Q86YL7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDPN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006465

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL21A1 (Collagen, Type XXI, alpha 1, COLA1L, DKFZp564B052, FLJ39125, FLJ44623, FP633, MGC26619, dJ682J15.1, dJ708F5.1) (MaxLight 405) discontinued
244829-ML405 100 µL

COL21A1 (Collagen, Type XXI, alpha 1, COLA1L, DKFZp564B052, FLJ39125, FLJ44623, FP633, MGC26619, dJ682J15.1, dJ708F5.1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)
MBS1054414-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)
MBS1054414-02 0.1 mg (E-Coli)

Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)
MBS1054414-03 0.02 mg (Yeast)

Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)
MBS1054414-04 0.1 mg (Yeast)

Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)
MBS1054414-05 0.02 mg (Baculovirus)

Recombinant Clostridium botulinum GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details