Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alg8 Rabbit Polyclonal Antibody (Biotin)

Alg8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC124750, Alg8

UniProt

Q497D1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001029299

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPH2, ID (TPH2, NTPH, Tryptophan 5-hydroxylase 2, Neuronal tryptophan hydroxylase, Tryptophan 5-monooxygenase 2) (MaxLight 650)
MBS6357634-01 0.1 mL

TPH2, ID (TPH2, NTPH, Tryptophan 5-hydroxylase 2, Neuronal tryptophan hydroxylase, Tryptophan 5-monooxygenase 2) (MaxLight 650)

Sign In for Pricing
View Details
TPH2, ID (TPH2, NTPH, Tryptophan 5-hydroxylase 2, Neuronal tryptophan hydroxylase, Tryptophan 5-monooxygenase 2) (MaxLight 650)
MBS6357634-02 5x 0.1 mL

TPH2, ID (TPH2, NTPH, Tryptophan 5-hydroxylase 2, Neuronal tryptophan hydroxylase, Tryptophan 5-monooxygenase 2) (MaxLight 650)

Sign In for Pricing
View Details
Cd276 Rat shRNA Lentiviral Particle (Locus ID 315716)
TL713594V 500 µL Each

Cd276 Rat shRNA Lentiviral Particle (Locus ID 315716)

Sign In for Pricing
View Details
PIRC3 AAV Vector (Human) (CMV)
36764101 1 µg

PIRC3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant HPV16 E7/Protein E7 Protein, N-His
E55P7105 50 µg

Recombinant HPV16 E7/Protein E7 Protein, N-His

Sign In for Pricing
View Details
ALDH1A1/2/3/ALDH2 Antibody [G9N14]
C22085-50uL 50 μL

ALDH1A1/2/3/ALDH2 Antibody [G9N14]

Sign In for Pricing
View Details