Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CISD2 Rabbit Polyclonal Antibody (Biotin)

CISD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERIS, WFS2, ZCD2, NAF-1, Miner1

UniProt

Q8N5K1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CISD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001008389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAG (Hedgehog/Smoothened agonist)
SF6836-10mM 10 mM x 0.2 mL

SAG (Hedgehog/Smoothened agonist)

Sign In for Pricing
View Details
CD8 a Rabbit mAb IHC Kit
KM3741-01 3 mL

CD8 a Rabbit mAb IHC Kit

Sign In for Pricing
View Details
CD8 a Rabbit mAb IHC Kit
KM3741-02 6 mL

CD8 a Rabbit mAb IHC Kit

Sign In for Pricing
View Details
CD8 a Rabbit mAb IHC Kit
KM3741-03 10 mL

CD8 a Rabbit mAb IHC Kit

Sign In for Pricing
View Details
RAB8A (Ras-related Protein Rab-8A, MEL, RAB8) (MaxLight 405)
MBS6434608-01 0.1 mL

RAB8A (Ras-related Protein Rab-8A, MEL, RAB8) (MaxLight 405)

Sign In for Pricing
View Details
RAB8A (Ras-related Protein Rab-8A, MEL, RAB8) (MaxLight 405)
MBS6434608-02 5x 0.1 mL

RAB8A (Ras-related Protein Rab-8A, MEL, RAB8) (MaxLight 405)

Sign In for Pricing
View Details