Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN1 Rabbit Polyclonal Antibody (HRP)

CLSTN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CST-1, CSTN1, CDHR12, PIK3CD, ALC-ALPHA, XB31alpha, alcalpha1, alcalpha2

UniProt

O94985

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLSTN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001009566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Myxococcus xanthus Elongation factor 4 (lepA), partial
MBS1485763 Inquire

Recombinant Myxococcus xanthus Elongation factor 4 (lepA), partial

Sign In for Pricing
View Details
LUL3 Antibody
orb790239 2 mg

LUL3 Antibody

Sign In for Pricing
View Details
GPN-Loop GTPase 1 (GPN1) Antibody
abx003374-01 100 µL

GPN-Loop GTPase 1 (GPN1) Antibody

Sign In for Pricing
View Details
GPN-Loop GTPase 1 (GPN1) Antibody
abx003374-02 200 µL

GPN-Loop GTPase 1 (GPN1) Antibody

Sign In for Pricing
View Details
CYP4F9P Protein Vector (Human) (pPM-C-HA)
PV072099 500 ng

CYP4F9P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
STON1 (Stonin-1, Stoned B-like Factor, SALF, SBLF, STN1, DKFZp781K2462, MGC149803, MGC149804) (MaxLight 405) discontinued
134010-ML405 100 µL

STON1 (Stonin-1, Stoned B-like Factor, SALF, SBLF, STN1, DKFZp781K2462, MGC149803, MGC149804) (MaxLight 405) discontinued

Sign In for Pricing
View Details