Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf30 Rabbit Polyclonal Antibody (HRP)

C20orf30 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSPC274, C20orf30, dJ1116H23.2.1

UniProt

Q96A57

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C20orf30

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054864

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS506565 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Mouse Gsto1 activation kit by CRISPRa
GA201771 1 Kit

Mouse Gsto1 activation kit by CRISPRa

Sign In for Pricing
View Details
KCNK9 (NM_016601) Human Over-expression Lysate
LC402572 20 µg

KCNK9 (NM_016601) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TANK Binding Kinase 1 (TBK1) ELISA Kit
RD-TBK1-Hu-01 96 Tests

Human TANK Binding Kinase 1 (TBK1) ELISA Kit

Sign In for Pricing
View Details
Human TANK Binding Kinase 1 (TBK1) ELISA Kit
RD-TBK1-Hu-02 48 Tests

Human TANK Binding Kinase 1 (TBK1) ELISA Kit

Sign In for Pricing
View Details
Human LASS3 (CERS3) activation kit by CRISPRa
GA116455 1 Kit

Human LASS3 (CERS3) activation kit by CRISPRa

Sign In for Pricing
View Details