Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLT8D1 Rabbit Polyclonal Antibody (Biotin)

GLT8D1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AD-017, MSTP139

UniProt

Q68CQ7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GLT8D1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001010983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR0B1, ID (NR0B1, AHC, DAX1, Nuclear receptor subfamily 0 group B member 1, DSS-AHC critical region on the X chromosome protein 1, Nuclear receptor DAX-1) (MaxLight 550)
MBS6326464-01 0.1 mL

NR0B1, ID (NR0B1, AHC, DAX1, Nuclear receptor subfamily 0 group B member 1, DSS-AHC critical region on the X chromosome protein 1, Nuclear receptor DAX-1) (MaxLight 550)

Sign In for Pricing
View Details
NR0B1, ID (NR0B1, AHC, DAX1, Nuclear receptor subfamily 0 group B member 1, DSS-AHC critical region on the X chromosome protein 1, Nuclear receptor DAX-1) (MaxLight 550)
MBS6326464-02 5x 0.1 mL

NR0B1, ID (NR0B1, AHC, DAX1, Nuclear receptor subfamily 0 group B member 1, DSS-AHC critical region on the X chromosome protein 1, Nuclear receptor DAX-1) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B (gatB)
MBS1319670-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B (gatB)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B (gatB)
MBS1319670-02 0.02 mg (Yeast)

Recombinant Synechococcus sp. Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B (gatB)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B (gatB)
MBS1319670-03 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B (gatB)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B (gatB)
MBS1319670-04 0.1 mg (Yeast)

Recombinant Synechococcus sp. Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B (gatB)

Sign In for Pricing
View Details