Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLT8D1 Rabbit Polyclonal Antibody (HRP)

GLT8D1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AD-017, MSTP139

UniProt

Q68CQ7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GLT8D1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001010983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gja1 3'UTR GFP Stable Cell Line
TU255106 1.0 mL

Gja1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2)
128546 50 µg

Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2)

Sign In for Pricing
View Details
STK19 (Serine/threonine-protein Kinase 19, G11, Protein G11, Protein RP1, RP1) (MaxLight 650)
MBS6224920-01 0.1 mL

STK19 (Serine/threonine-protein Kinase 19, G11, Protein G11, Protein RP1, RP1) (MaxLight 650)

Sign In for Pricing
View Details
STK19 (Serine/threonine-protein Kinase 19, G11, Protein G11, Protein RP1, RP1) (MaxLight 650)
MBS6224920-02 5x 0.1 mL

STK19 (Serine/threonine-protein Kinase 19, G11, Protein G11, Protein RP1, RP1) (MaxLight 650)

Sign In for Pricing
View Details
Monoclonal ME1 Antibody (monoclonal) (M02), Clone: 3B4
APR08407G 0.1mg

Monoclonal ME1 Antibody (monoclonal) (M02), Clone: 3B4

Sign In for Pricing
View Details
SµLt1b1 Mouse shRNA Plasmid (Locus ID 56362)
TL510308 1 Kit

SµLt1b1 Mouse shRNA Plasmid (Locus ID 56362)

Sign In for Pricing
View Details