Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAMD2A Rabbit Polyclonal Antibody (HRP)

GRAMD2A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GRAMD2

UniProt

Q8IUY3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GRAMD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001012660

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROSC Adenovirus (Rat)
37744056 1.0 mL

PROSC Adenovirus (Rat)

Sign In for Pricing
View Details
DNASE2B Antibody
orb1245619 100 µL

DNASE2B Antibody

Sign In for Pricing
View Details
Recombinant Human Ephrin-A1 Protein, His Tag
KMP1262 50 µg

Recombinant Human Ephrin-A1 Protein, His Tag

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)
MBS2117157-01 1 mL

APC-Cy7 Linked Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)
MBS2117157-02 5 mL

APC-Cy7 Linked Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)
MBS2117157-03 5x 5 mL

APC-Cy7 Linked Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)

Sign In for Pricing
View Details