Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR11H12 Rabbit Polyclonal Antibody (FITC)

OR11H12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

B2RN74

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OR11H12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sonicator Q800R3 with no tube holder
HOM2344 1 Each

Sonicator Q800R3 with no tube holder

Sign In for Pricing
View Details
Rabbit Monoclonal Complement Component C5a Antibody (442) [DyLight 650]
NBP2-89580C 0.1 mL

Rabbit Monoclonal Complement Component C5a Antibody (442) [DyLight 650]

Sign In for Pricing
View Details
Recombinant Human Ig alpha-1 chain C region (IGHA1)
MBS950448-01 0.02 mg (E-Coli)

Recombinant Human Ig alpha-1 chain C region (IGHA1)

Sign In for Pricing
View Details
Recombinant Human Ig alpha-1 chain C region (IGHA1)
MBS950448-02 0.02 mg (Yeast)

Recombinant Human Ig alpha-1 chain C region (IGHA1)

Sign In for Pricing
View Details
Recombinant Human Ig alpha-1 chain C region (IGHA1)
MBS950448-03 0.1 mg (E-Coli)

Recombinant Human Ig alpha-1 chain C region (IGHA1)

Sign In for Pricing
View Details
Recombinant Human Ig alpha-1 chain C region (IGHA1)
MBS950448-04 0.1 mg (Yeast)

Recombinant Human Ig alpha-1 chain C region (IGHA1)

Sign In for Pricing
View Details